Antibody data

Product number
H00023660-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023660-M01, RRID:AB_1582026
Product name
ZKSCAN5 monoclonal antibody (M01), clone 1A7
Provider product page
Abnova Corporation - H00023660-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ZKSCAN5.
Antigen sequence
MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDC
TWMQEYNPPTFETFYQRFRHFQYHEASGPREALSQ
LRVLCCEWLRPELHTKEQILELLVLEQFLTILPEE
FQPWVREHHPESGEEAVAVIENIQRELEERRQQIV
ACPDVLPRKMATPGAVQESCSPHPLTVDTQPEQAP
QKPRLLEENALPVLQVPSLPLKDSQELTASLLSTG
SQKLVKIEEVADVAVSFILEEWGHLDQSQKSLYRD
DRKENYGSITSMGYESRDNMELIVKQISDDSESHW
VAPEHTERSVPQDPDFAEVSDLKGMVQRWQVNPTV
GKSRQNPSQKRDLDAITDISPKQSTHGERGHRCSD
CGKFFLQASNFIQHRRIHTGEKPFKCGECGKSYNQ
RVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLVQH
HSVHSGERPYGCNECGKNFGRHSHLIEHLKRHFRE
KSQRCSDKRSKNTKLSVKKKISEYSEADMELSGKT
QRNVSQVQDFGEGCEFQGKLDRKQGIPMKEILGQP
SSKRMNYSEVPYVHKKSSTGERPHKCNECGKSFIQ
SAHLIQHQRIHTGEKPFRCEECGKSYNQRVHLTQH
QRVHTGEKPYTCPLCGKAFRVRSHLVQHQSVHSGE
RPFKCNECGKGFGRRSHLAGHLRLHSREKSHQCRE
CGEIFFQYASLIEHQVLHMGQKNEKNGICEEAYSW
NLTVIEDKKIELQEQPYQCDICGKAFGYSSDLIQH
YRTHTAEKPYQCDICRENVGQCSHTKQHQKIYSST
KSHQCHECGRGFTLKSHLNQHQGIHTGEKPFQCKE
CGMNFSWSCSLFKHLRSHERTDPINTLSVEGSLL
Isotype
IgG
Antibody clone number
1A7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -