HPA003201

ZKSCAN5 antibody from Sigma-Aldrich
ZFP95, ZNF914, ZSCAN37
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003201
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003201, RRID:AB_10610701
Product name
Anti-ZKSCAN5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003201
Antibody type
Polyclonal
Antigen
zinc finger with KRAB and SCAN domains 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHHPESGEEAVAVIENIQRELEERRQQIVACPDVL
PRKMATPGAVQESCSPHPLTVDTQPEQAPQKPRLL
EENALPVLQVPSLPLKDSQELTASLLSTGSQKLVK
IEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENY
GSITS
Storage
-20C
Provider Type Product Number
- No reagents -