Antibody data

Product number
PAB28739
Provider
Abnova Corporation
Product name
SULT4A1 polyclonal antibody
Provider product page
Abnova Corporation - PAB28739
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SULT4A1.
Antigen sequence
GEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSD
VWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNI
DEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFL
PSDLHNGDSKVIYMARNPKDLVVSYYQFHRSL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -