HPA003129

SULT4A1 antibody from Sigma-Aldrich
hBR-STL-1, SULTX3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003129
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003129, RRID:AB_1080130
Product name
Anti-SULT4A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003129
Antibody type
Polyclonal
Antigen
Sulfotransferase 4A1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSD
VWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNI
DEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFL
PSDLHNGDSKVIYMARNPKDLVVSYYQFHRSL
Storage
-20C
Provider Type Product Number
- No reagents -