HPA015672

TMEM74 antibody from Sigma-Aldrich
FLJ30668, NET36
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015672
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015672, RRID:AB_1858132
Product name
Anti-TMEM74 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015672
Antibody type
Polyclonal
Antigen
Transmembrane protein 74 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HYLAKKSNQADLCDARDWSSRGLPGDQADTAATRA
ALCCQKQCASTPRATEMEGSKLSSSPASPSSSLQN
STLQPDAFPPGLLHSGNNQITAERKVCNCCSQELE
TSFTYVDKNINLEQRNRSSPSAKGHNHPGELGWEN
PNEW
Storage
-20C
Provider Type Product Number
- No reagents -