HPA014597

MARCHF8 antibody from Atlas Antibodies
c-MIR, CMIR, MARCH-VIII, MARCH8, MIR, RNF178
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014597
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014597, RRID:AB_1853580
Product name
Anti-MARCH8
Provider product page
Atlas Antibodies - HPA014597
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFE
KSPLTEPNFENKHGHGICHSDTNSSCCTEPEDTGA
EIIHV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -