HPA017992

MARF1 antibody from Sigma-Aldrich
KIAA0430, LKAP, LMKB, Marf1, PPP1R34
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017992
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017992, RRID:AB_1852921
Product name
Anti-KIAA0430 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017992
Antibody type
Polyclonal
Antigen
Limkain-b1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPVCLKGSLYCEDCLNKPARNSIIDAAKVWPNIPP
PNTQPAPLAVPLCNGCGTKGTGKETTLLLATSLGK
AASKFGSPEVAVAGQVLENLPPIGVFWDIENCSVP
SGRSATAVVQRIREKFFKGHREAEFICVCDISKEN
KE
Storage
-20C
Provider Type Product Number
- No reagents -