H00112476-B01P

PRRT2 antibody from Abnova Corporation
DKFZp547J199, DSPB3, DYT10, EKD1, FICCA, FLJ25513, ICCA, IFITMD1, PKC

Antibody data

Product number
H00112476-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00112476-B01P, RRID:AB_1579221
Product name
PRRT2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00112476-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PRRT2 protein.
Antigen sequence
MAASSSEISEMKGVEESPKVPGEGPGHSEAETGPP
QVLAGVPDQPEAPQPGPNTTAAPVDSGPKAGLAPE
TTETPAGASETAQATDLSLSPGGESKANCSPEDPC
QETVSKPEVSKEATADQGSRLESAAPPEPAPEPAP
QPDPRPDSQPTPKPALQPELPTQEDPTPEILSESV
GEKQENGAVVPLQAGDGEEGPAPEPHSPPSKKSPP
ANGAPPRVLQQLVEEDRMRRAHSGHPGSPRGSLSR
HPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPM
WPVNIVAFAYAVMSRNSLQQGDVDGAQRLGRVAKL
LSIVALVGGVLIIIASCVINLGVYK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -