HPA014526

VSIG10 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014526
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014526, RRID:AB_1848785
Product name
Anti-AC131238.3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014526
Antibody type
Polyclonal
Antigen
Ig-like domain-containing protein FLJ20674 precursor
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLQGNYTCLALNQLSKRHRKVTTELLVYYPPPSAP
QCWAQMASGSFMLQLTCRWDGGYPDPDFLWIEEPG
GVIVGKSKLGVEMLSESQLSDGKKFKCVTSHIVGP
ESGASCMVQIRGPSLLSEPMKT
Storage
-20C
Provider Type Product Number
- No reagents -