Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311076 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NEK6 antibody: synthetic peptide directed towards the N terminal of human NEK6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVA
LKKVQ IFEMMDAKAR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human NIMA-related kinase 6 is one of the Fe65 WW domain binding proteins.
Lee EJ, Hyun SH, Chun J, Kang SS
Biochemical and biophysical research communications 2007 Jul 6;358(3):783-8
Biochemical and biophysical research communications 2007 Jul 6;358(3):783-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting