WH0009533M1

POLR1C antibody from Sigma-Aldrich
RPA39, RPA40, RPA5, RPAC1
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0009533M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0009533M1, RRID:AB_1843064
Product name
Monoclonal Anti-POLR1C antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0009533M1
Antibody type
Monoclonal
Antigen
POLR1C (AAH08863, a.a. 1-347) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSG
YDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA
AIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEI
LAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQF
RLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTW
IPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDL
LMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPV
EGEAAEELSR (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -