HPA031010

POLR1C antibody from Atlas Antibodies
RPA39, RPA40, RPA5, RPAC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA031010
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA031010, RRID:AB_10603131
Product name
Anti-POLR1C
Provider product page
Atlas Antibodies - HPA031010
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDE
EGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVN
HKVYTRHMTWIPLGNQADLFPEGTIRPVHD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -