Antibody data

Product number
H00009533-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009533-M05, RRID:AB_464069
Product name
POLR1C monoclonal antibody (M05), clone M1
Provider product page
Abnova Corporation - H00009533-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant POLR1C.
Antigen sequence
MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSG
YDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA
AIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEI
LAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQF
RLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTW
IPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDL
LMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPV
EGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRL
DTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGV
LPPDVLVSEAIKVLMGKCRRFLDELDAVQMD
Isotype
IgG
Antibody clone number
M1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -