HPA031010

POLR1C antibody from Sigma-Aldrich
RPA39, RPA40, RPA5, RPAC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031010
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA031010, RRID:AB_10603131
Product name
Anti-POLR1C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA031010
Antibody type
Polyclonal
Antigen
polymerase (RNA) I polypeptide C, 30kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDE
EGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVN
HKVYTRHMTWIPLGNQADLFPEGTIRPVHD
Storage
-20C
Provider Type Product Number
- No reagents -