HPA014527

C19orf18 antibody from Sigma-Aldrich
MGC41906
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014527
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014527, RRID:AB_1845612
Product name
Anti-C19orf18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014527
Antibody type
Polyclonal
Antigen
Uncharacterized protein C19orf18 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HPTGNITGLPGSKRSQPPRNITKEPKVFFHKTQLP
GIQGAASRSTAASPTNPMKFLRNKAIIRHRPALVK
Storage
-20C
Provider Type Product Number
- No reagents -