Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004723-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004723-M01, RRID:AB_606652
- Product name
- NDUFV1 monoclonal antibody (M01), clone 4A7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NDUFV1.
- Antigen sequence
KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARF
VRGDARPAEIDSLWEISKQIEGHTICALGDGAAWP
VQGLIRHFRPELEERMQRFAQQHQARQAAS- Isotype
- IgG
- Antibody clone number
- 4A7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Human ind1, an iron-sulfur cluster assembly factor for respiratory complex I.
Sheftel AD, Stehling O, Pierik AJ, Netz DJ, Kerscher S, Elsässer HP, Wittig I, Balk J, Brandt U, Lill R
Molecular and cellular biology 2009 Nov;29(22):6059-73
Molecular and cellular biology 2009 Nov;29(22):6059-73
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NDUFV1 expression in transfected 293T cell line by NDUFV1 monoclonal antibody (M01), clone 4A7.Lane 1: NDUFV1 transfected lysate(50.8 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NDUFV1 monoclonal antibody (M01), clone 4A7. Western Blot analysis of NDUFV1 expression in PC-12.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NDUFV1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol