Antibody data

Product number
H00055165-M05
Provider
Abnova Corporation
Product name
CEP55 monoclonal antibody (M05), clone 6A10
Provider product page
Abnova Corporation - H00055165-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CEP55.
Antigen sequence
MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIA
HLKASVDEITSGKGKLTDKERHRLLEKIRVLEAEK
EKNAYQLTEKDKEIQRLRDQLKARYSTTALLEQLE
ETTREGERREQVLKALSEEKDVLKQQLSAATSRIA
ELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLK
DALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTE
TAAHSLPQQTKKPESEGYLQEEKQKCYNDLLASAK
KDLEVERQTITQLSFELSEFRRKYEETQKEVHNLN
QLLYSQRRADVQHLEDDRHKTEKIQKLREENDIAR
GKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVA
LLEQQMQACTLDFENEKLDRQHVQHQLLVILKELR
KARNQITQLESLKQLHEFAITEPLVTFQGETENRE
KVAASPKSPTAALNESLVECPKCNIQYPATEHRDL
LVHVEYCSK
Isotype
IgG
Antibody clone number
6A10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -