HPA014687

FAM187B antibody from Sigma-Aldrich
FLJ25660, TMEM162
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014687
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014687, RRID:AB_2101358
Product name
Anti-FAM187B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014687
Antibody type
Polyclonal
Antigen
Protein FAM187B Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALLSGNDILLYCNSSGAHWYYLFTQGKKGRLTSLT
NISNMEIMPEGSLLIKDPLPSQTGLYHCWNKNGRQ
VVQYEIDFQDVTTLHITHKDLGQRPLQNETLHL
Storage
-20C
Provider Type Product Number
- No reagents -