Explore
Validate
LearnH00026119-M01
antibody from Abnova Corporation
Targeting: LDLRAP1
ARH, ARH2, DKFZp586D0624, FHCB1, FHCB2, MGC34705
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026119-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026119-M01, RRID:AB_425923
- Product name
- LDLRAP1 monoclonal antibody (M01), clone 4G4-D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant LDLRAP1.
- Antigen sequence
MLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKA
SGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYR
ISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTK
RKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKA
SQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAK
APLSTVSANTTNMDEVPRPQALSGSSVVWELDDGL
DEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPV
DWDKPDSSGTEQDDLFSF- Isotype
- IgG
- Antibody clone number
- 4G4-D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Disabled-2 protein facilitates assembly polypeptide-2-independent recruitment of cystic fibrosis transmembrane conductance regulator to endocytic vesicles in polarized human airway epithelial cells.
Autosomal recessive hypercholesterolemia in Spanish kindred due to a large deletion in the ARH gene.
Cihil KM, Ellinger P, Fellows A, Stolz DB, Madden DR, Swiatecka-Urban A
The Journal of biological chemistry 2012 Apr 27;287(18):15087-99
The Journal of biological chemistry 2012 Apr 27;287(18):15087-99
Autosomal recessive hypercholesterolemia in Spanish kindred due to a large deletion in the ARH gene.
Quagliarini F, Vallvé JC, Campagna F, Alvaro A, Fuentes-Jimenez FJ, Sirinian MI, Meloni F, Masana L, Arca M
Molecular genetics and metabolism 2007 Nov;92(3):243-8
Molecular genetics and metabolism 2007 Nov;92(3):243-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LDLRAP1 monoclonal antibody (M01), clone 4G4-D5 Western Blot analysis of LDLRAP1 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of LDLRAP1 expression in transfected 293T cell line by LDLRAP1 monoclonal antibody (M01), clone 4G4-D5.Lane 1: LDLRAP1 transfected lysate(29 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LDLRAP1 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to LDLRAP1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to LDLRAP1 on formalin-fixed paraffin-embedded human maligant fibrous histiocytoma tissue. [antibody concentration 2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
