HPA014523

CD300C antibody from Sigma-Aldrich
CMRF-35A, CMRF35, CMRF35A, IGSF16, LIR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014523
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014523, RRID:AB_1846293
Product name
Anti-CD300C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014523
Antibody type
Polyclonal
Antigen
CMRF35-like molecule 6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTS
GPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Storage
-20C
Provider Type Product Number
- No reagents -