HPA014523

CD300C antibody from Atlas Antibodies
CMRF-35A, CMRF35, CMRF35A, IGSF16, LIR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014523
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014523, RRID:AB_1846293
Product name
Anti-CD300C
Provider product page
Atlas Antibodies - HPA014523
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTS
GPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -