Antibody data

Product number
H00000222-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000222-M01, RRID:AB_425298
Product name
ALDH3B2 monoclonal antibody (M01), clone 3E6
Provider product page
Abnova Corporation - H00000222-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant ALDH3B2.
Antigen sequence
MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNY
PLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLA
EVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFF
TGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDD
NCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEM
QERLLPALQSTITRFYGDDPQSSPNLGRIINQKQF
QRLRALLGCGRVAIGGQSNESDRYIAPTVLVDVQE
TEPVMQEEIFGPILPIVNVQSVDEAIKFINWQEKP
LALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYIS
LLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLA
PSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
Isotype
IgG
Antibody clone number
3E6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -