HPA014504

TMEM223 antibody from Sigma-Aldrich
MGC3196
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014504
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014504, RRID:AB_1853881
Product name
Anti-TMEM223 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014504
Antibody type
Polyclonal
Antigen
Transmembrane protein MGC3196 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQ
VSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPN
TKLFDNTVGAYRSL
Storage
-20C
Provider Type Product Number
- No reagents -