Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000387-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000387-M04, RRID:AB_464043
- Product name
- RHOA monoclonal antibody (M04), clone 1B12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant RHOA.
- Antigen sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYV
PTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKH
FCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVK
PEEGRDMANRIGAFGYMECSAKTKDGVREVFEMAT
RAALQARRGKKKSGCLVL- Isotype
- IgG
- Antibody clone number
- 1B12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references RhoA is associated with invasion and poor prognosis in colorectal cancer.
Relationship of RhoA signaling activity with ezrin expression and its significance in the prognosis for breast cancer patients.
Jeong D, Park S, Kim H, Kim CJ, Ahn TS, Bae SB, Kim HJ, Kim TH, Im J, Lee MS, Kwon HY, Baek MJ
International journal of oncology 2016 Feb;48(2):714-22
International journal of oncology 2016 Feb;48(2):714-22
Relationship of RhoA signaling activity with ezrin expression and its significance in the prognosis for breast cancer patients.
Ma L, Liu YP, Zhang XH, Geng CZ, Li ZH
Chinese medical journal 2013 Jan;126(2):242-7
Chinese medical journal 2013 Jan;126(2):242-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RHOA monoclonal antibody (M04), clone 1B12 Western Blot analysis of RHOA expression in HL-60 ( Cat # L014V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RHOA expression in transfected 293T cell line by RHOA monoclonal antibody (M04), clone 1B12.Lane 1: RHOA transfected lysate(21.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RHOA is approximately 10ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RHOA on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RHOA on formalin-fixed paraffin-embedded human lymphoma tissue.[antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol