HPA015663

CD163L1 antibody from Sigma-Aldrich
CD163B, M160
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015663
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015663, RRID:AB_2072575
Product name
Anti-CD163L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015663
Antibody type
Polyclonal
Antigen
Scavenger receptor cysteine-rich type 1 protein M160 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSD
DTPNHGCEDASDTSLLGVLPASEAT
Storage
-20C
Provider Type Product Number
- No reagents -