Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028940 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-HSBP1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRI
DDMSSRIDDLEKNIADLMTQAGVEELESENKIPAT
QK- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references
The trimeric coiled‐coil
HSBP
1 protein promotes
WASH
complex assembly at centrosomes
Visweshwaran S, Thomason P, Guerois R, Vacher S, Denisov E, Tashireva L, Lomakina M, Lazennec‐Schurdevin C, Lakisic G, Lilla S, Molinie N, Henriot V, Mechulam Y, Alexandrova A, Cherdyntseva N, Bièche I, Schmitt E, Insall R, Gautreau A
The EMBO Journal 2018;37(13)
The EMBO Journal 2018;37(13)
No comments: Submit comment
No validations: Submit validation data