Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405005 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Heat Shock Factor Binding Protein 1 (HSBP1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HSBP1 antibody: synthetic peptide directed towards the N terminal of human HSBP1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIG
RIDDM SSRIDDLEKN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Structure-function analysis of the heat shock factor-binding protein reveals a protein composed solely of a highly conserved and dynamic coiled-coil trimerization domain.
Tai LJ, McFall SM, Huang K, Demeler B, Fox SG, Brubaker K, Radhakrishnan I, Morimoto RI
The Journal of biological chemistry 2002 Jan 4;277(1):735-45
The Journal of biological chemistry 2002 Jan 4;277(1):735-45
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting