HPA014479

GSG1L antibody from Atlas Antibodies
KTSR5831, MGC18079, PRO19651
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014479
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014479, RRID:AB_2247974
Product name
Anti-GSG1L
Provider product page
Atlas Antibodies - HPA014479
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QGYREEPTFIDPEAIKYFRERMEKRDGSEEDFHLD
CRHERYPARHQPHMADSWPRSSAQEAPELNRQCWV
LGHWV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -