HPA014811

GYPA antibody from Sigma-Aldrich
CD235a, GPA, MN, MNS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014811
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014811, RRID:AB_1849827
Product name
Anti-GYPA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014811
Antibody type
Polyclonal
Antigen
Glycophorin-A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEI
SVRTVYPPEEETGERVQLAHHFSEP
Storage
-20C
Provider Type Product Number
- No reagents -