HPA029386

GAPVD1 antibody from MilliporeSigma / Merck KGaA
DKFZP434C212, KIAA1521
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029386
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029386, RRID:AB_10599604
Product name
Anti-GAPVD1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029386
Antibody type
Polyclonal
Antigen
GTPase activating protein and VPS9 domains 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSLDLEGESVSELGAGPSGSNGVEALQLLEHEQAT
TQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWS
TDVLGSDFDPNIDEDRLQEIAGAAAENMLGSLLCL
PGSGSVLL
Storage
-20C
Provider Type Product Number
- No reagents -