Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027094-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027094-A01, RRID:AB_627425
- Product name
- KCNMB3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant KCNMB3.
- Antigen sequence
FMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCH
GQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPK
CFYTPKCHQDRNDLLNSALDIKEFFDHKNG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Accelerated Ca2+ entry by membrane hyperpolarization due to Ca2+-activated K+ channel activation in response to histamine in chondrocytes.
Gender difference in BK channel expression in amygdala complex of rat brain.
Differential distribution of Ca2+-activated potassium channel beta4 subunit in rat brain: immunolocalization in neuronal mitochondria.
Funabashi K, Ohya S, Yamamura H, Hatano N, Muraki K, Giles W, Imaizumi Y
American journal of physiology. Cell physiology 2010 Apr;298(4):C786-97
American journal of physiology. Cell physiology 2010 Apr;298(4):C786-97
Gender difference in BK channel expression in amygdala complex of rat brain.
Ohno A, Ohya S, Yamamura H, Imaizumi Y
Biochemical and biophysical research communications 2009 Jan 23;378(4):867-71
Biochemical and biophysical research communications 2009 Jan 23;378(4):867-71
Differential distribution of Ca2+-activated potassium channel beta4 subunit in rat brain: immunolocalization in neuronal mitochondria.
Piwonska M, Wilczek E, Szewczyk A, Wilczynski GM
Neuroscience 2008 May 2;153(2):446-60
Neuroscience 2008 May 2;153(2):446-60
No comments: Submit comment
No validations: Submit validation data