Antibody data

Product number
H00027094-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027094-M11, RRID:AB_1204561
Product name
KCNMB3 monoclonal antibody (M11), clone 2C12
Provider product page
Abnova Corporation - H00027094-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant KCNMB3.
Antigen sequence
FMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCH
GQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPK
CFYTPKCHQDRNDLLNSALDIKEFFDHKNG
Isotype
IgG
Antibody clone number
2C12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -