Antibody data

Product number
H00027094-M15
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027094-M15, RRID:AB_1204563
Product name
KCNMB3 monoclonal antibody (M15), clone 3E5
Provider product page
Abnova Corporation - H00027094-M15
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant KCNMB3.
Antigen sequence
FMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCH
GQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPK
CFYTPKCHQDRNDLLNSALDIKEFFDHKNG
Isotype
IgG
Antibody clone number
3E5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -