HPA015665

KCNMB3 antibody from Sigma-Aldrich
KCNMB2, KCNMBL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015665
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015665, RRID:AB_1852142
Product name
Anti-KCNMB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015665
Antibody type
Polyclonal
Antigen
Calcium-activated potassium channel subunit beta-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQV
FVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQD
RNDLLNSALDIKEFFDHKNGTPFSCFYSPASQ
Storage
-20C
Provider Type Product Number
- No reagents -