Antibody data

Product number
H00009587-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009587-M03, RRID:AB_1576965
Product name
MAD2L1BP monoclonal antibody (M03), clone 4G11
Provider product page
Abnova Corporation - H00009587-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MAD2L1BP.
Antigen sequence
MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLE
TSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCC
QFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQA
EEMLKKKPRATTEVSSRKCQQALAELESVLSHLED
FFARTLVPRVLILLGGNALSPKEFYELDLSLLAPY
SVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMG
TVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTL
SCGRPSIRTTAWEDYIWFQAPVTFKGFRE
Isotype
IgG
Antibody clone number
4G11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -