H00009587-M13

MAD2L1BP antibody from Abnova Corporation
CMT2, dJ261G23.1, KIAA0110

Antibody data

Product number
H00009587-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009587-M13, RRID:AB_1237770
Product name
MAD2L1BP monoclonal antibody (M13), clone 4B9
Provider product page
Abnova Corporation - H00009587-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAD2L1BP.
Antigen sequence
LLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQA
PPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHK
LTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE
Isotype
IgG
Antibody clone number
4B9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -