Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084676-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084676-M01, RRID:AB_509227
- Product name
- TRIM63 monoclonal antibody (M01), clone 6G6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRIM63.
- Antigen sequence
DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVE
ASKGCQLGKTEQGFENMDFFTLDLEHIADALRAID
FGTDEEEEEFIEEEDQEEEESTEGKEEGH- Isotype
- IgG
- Antibody clone number
- 6G6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TRIM63 expression in transfected 293T cell line by TRIM63 monoclonal antibody (M01), clone 6G6.Lane 1: TRIM63 transfected lysate(40.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TRIM63 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TRIM63 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol