HPA019441

TMEM51 antibody from Atlas Antibodies
C1orf72, FLJ10199

Antibody data

Product number
HPA019441
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019441, RRID:AB_2670142
Product name
Anti-TMEM51
Provider product page
Atlas Antibodies - HPA019441
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EDSQEEEEEDEEAASRYYVPSYEEVMNTNYSEARG
EEQNPRLSISLPSYESLTGLDETTPTSTRADVEAS
PGNPPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFR
ITLP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -