PAB20739

TMEM51 antibody from Abnova Corporation
C1orf72, FLJ10199

Antibody data

Product number
PAB20739
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20739, RRID:AB_10962790
Product name
TMEM51 polyclonal antibody
Provider product page
Abnova Corporation - PAB20739
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TMEM51.
Antigen sequence
EDSQEEEEEDEEAASRYYVPSYEEVMNTNYSEARG
EEQNPRLSISLPSYESLTGLDETTPTSTRADVEAS
PGNPPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFR
ITLP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -