ABIN405904

TMEM51 antibody from antibodies-online
C1orf72, FLJ10199

Antibody data

Product number
ABIN405904
Provider
antibodies-online
Product name
anti-Transmembrane Protein 51 (TMEM51) antibody
Provider product page
antibodies-online - ABIN405904
Antibody type
Polyclonal
Antigen
The immunogen for anti-TMEM51 antibody: synthetic peptide directed towards the N terminal of human TMEM51
Reactivity
Human, Rat, Canine
Host
Rabbit
Antigen sequence
GFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLV
GAGVM LLLLSICLSI
Vial size
50 µg
Provider Type Product Number
- No reagents -