HPA014547

TMEM51 antibody from Sigma-Aldrich
C1orf72, FLJ10199
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014547
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014547, RRID:AB_1858121
Product name
Anti-TMEM51 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014547
Antibody type
Polyclonal
Antigen
Transmembrane protein 51 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDSQEEEEEDEEAASRYYVPSYEEVMNTNYSEARG
EEQNPRLSISLPSYESLTGLDETTPTSTRADVEAS
PGNPPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFR
ITLP
Storage
-20C
Provider Type Product Number
- No reagents -