HPA014547

TMEM51 antibody from Atlas Antibodies
C1orf72, FLJ10199
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014547
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014547, RRID:AB_1858121
Product name
Anti-TMEM51
Provider product page
Atlas Antibodies - HPA014547
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EDSQEEEEEDEEAASRYYVPSYEEVMNTNYSEARG
EEQNPRLSISLPSYESLTGLDETTPTSTRADVEAS
PGNPPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFR
ITLP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -