SAB2102471

TMEM51 antibody from Sigma-Aldrich
C1orf72, FLJ10199
No application information provided.

Antibody data

Product number
SAB2102471
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102471, RRID:AB_10607730
Product name
Anti-TMEM51 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102471
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_060492.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLV
GAGVMLLLLSICLSI
Storage
-20C
Provider Type Product Number
- No reagents -