Antibody data

Product number
H00023406-M01
Provider
Abnova Corporation
Product name
COTL1 monoclonal antibody (M01), clone 1A2
Provider product page
Abnova Corporation - H00023406-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant COTL1.
Antigen sequence
MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGST
IVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAM
SKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVV
QNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQ
TE
Isotype
IgG
Antibody clone number
1A2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -