HPA028600

UBXN11 antibody from MilliporeSigma / Merck KGaA
SOC, SOCI, UBXD5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028600
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028600, RRID:AB_10604001
Product name
Anti-UBXN11 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028600
Antibody type
Polyclonal
Antigen
UBX domain protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SENGEQAFLLMMQPDNTIGDVRALLAQARVMDASA
FEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRAR
RAPKSSLKFSPGP
Storage
-20C
Provider Type Product Number
- No reagents -