Antibody data

Product number
PAB20175
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20175, RRID:AB_10968439
Product name
SCUBE1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20175
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SCUBE1.
Antigen sequence
EVSHITAEFEIETKMEEASDTCEADCLRKRAEQSL
QAAIKTLRKSIGRQQFYVQVSGTEYEVAQRPAKAL
EGQGACGAGQVLQDSKCVACGPGTHFGGELGQCVP
CMPGTYQDMEGQLSCTPCPSSDGLGLPGARNVSEC
GGKC
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -