HPA003190

SCUBE1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003190
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003190, RRID:AB_1079882
Product name
Anti-SCUBE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003190
Antibody type
Polyclonal
Antigen
Signal peptide, CUB and EGF-like domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVSHITAEFEIETKMEEASDTCEADCLRKRAEQSL
QAAIKTLRKSIGRQQFYVQVSGTEYEVAQRPAKAL
EGQGACGAGQVLQDSKCVACGPGTHFGGELGQCVP
CMPGTYQDMEGQLSCTPCPSSDGLGLPGARNVSEC
GGKC
Storage
-20C
Provider Type Product Number
- No reagents -