Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311608 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Metallothionein-Like 5, Testis-Specific (Tesmin) (MTL5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MTL5 antibody: synthetic peptide directed towards the N terminal of human MTL5
- Description
- Affinity Purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
EAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAG
GDSDG GELLGEYPGI- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Transcriptome analysis of human gastric cancer.
Oh JH, Yang JO, Hahn Y, Kim MR, Byun SS, Jeon YJ, Kim JM, Song KS, Noh SM, Kim S, Yoo HS, Kim YS, Kim NS
Mammalian genome : official journal of the International Mammalian Genome Society 2005 Dec;16(12):942-54
Mammalian genome : official journal of the International Mammalian Genome Society 2005 Dec;16(12):942-54
No comments: Submit comment
No validations: Submit validation data