Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00050515-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00050515-M01, RRID:AB_509108
- Product name
- CHST11 monoclonal antibody (M01), clone 4F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CHST11.
- Antigen sequence
RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYS
LCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYL
KFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVY
KLD- Isotype
- IgG
- Antibody clone number
- 4F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CHST11 monoclonal antibody (M01), clone 4F1 Western Blot analysis of CHST11 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CHST11 expression in transfected 293T cell line by CHST11 monoclonal antibody (M01), clone 4F1.Lane 1: CHST11 transfected lysate (Predicted MW: 41.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CHST11 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol