H00079690-M01

GAL3ST4 antibody from Abnova Corporation
FLJ12116
No application information provided.

Antibody data

Product number
H00079690-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079690-M01, RRID:AB_1137224
Product name
GAL3ST4 monoclonal antibody (M01), clone 4E4
Provider product page
Abnova Corporation - H00079690-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GAL3ST4.
Antigen sequence
RLQTAVAELRARREALAKHCLVGGEASDPKYITDR
RFRPFQFGSAKVLGYILRSGLSPQDQEECERLATP
ELQYKDKLDAKQFPPTVSLPLKTSRPLSP
Isotype
IgG
Antibody clone number
4E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -